Tashbar Sephardic Jewish School in Los Angeles, California - Elementary Yeshiva
Tashbar Sephardic Yeshiva Ketana Hebrew Academy is the only Sephardic Yeshiva Day School located in the Pico-Robertson area of Los Angeles. Our educational program emphasizes Torah Studies with a strong General Studies component.
tashbarsephardicyeshivaketana.com is not currently ranked anywhere. tashbarsephardicyeshivaketana.com was launched at August 26, 2015 and is 9 years and 77 days. It reaches roughly 30 users and delivers about 30 pageviews each month. Its estimated monthly revenue is $0.00. We estimate the value of tashbarsephardicyeshivaketana.com to be around $10.00. The domain tashbarsephardicyeshivaketana.com uses a Commercial suffix and its server(s) are located in with the IP number 192.185.116.168. tashbarsephardicyeshivaketana.com is not listed on Dmoz.
Webmaster and SEO Tools
SEO Tools > Keyword Density Check
CloseWorth & Traffic Estimate of tashbarsephardicyeshivaketana.com
Estimated numbers for tashbarsephardicyeshivaketana.com - Niche: General - Average CPM: $2.80 CPM or eCPM: Effective Cost per 1000 impressions.For publishers it means average earnings for each 1k impressions.
Example: A website with a $3 CPM and 10000 impressions/pageviews a day is making on average $30 dollars a day.
Daily
Monthly
Yearly
Website Worth: $10.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Daily Pageviews: 1
Daily Visitors: 1
Daily Ads Revenue: $0.00
Website Worth: $10.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Monthly Pageviews: 30
Monthly Visitors: 30
Monthly Ads Revenue: $0.00
Website Worth: $10.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Yearly Pageviews: 365
Yearly Visitors: 365
Yearly Ads Revenue: $0.00
Choose a specific category/niche The value and earnings of a website just like a physical company also depends on the market it's focusing.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
Automobile
$4.30
Average High priced niches
$8.00
Average Low priced niches
$2.00
B2B
$8.00
Banking and Finance
$12.00
Books & Online content
$2.00
Consumer durables
$3.00
Dating
$3.50
Education
$9.00
Entertainment
$1.00
Fashion and Clothing
$1.50
Fitness
$6.00
Food
$4.00
Gaming
$1.50
General
$2.80
Hotels and Travel
$3.50
IT hardware
$6.00
Jobs
$2.50
Legal
$15.00
Machinery or equipment
$3.00
Medical treatment
$8.00
Medicines
$4.00
Miracle drugs or vitamins
$3.50
Music
$1.00
News Portals
$10.00
Random blogs or content
$1.00
Real Estate
$7.20
Religion
$1.70
Science
$4.50
Shopping Portals
$2.50
Social networks
$0.70
Sports
$2.00
Technology
$8.50
Webmaster & Web Hosting
$12.00
Main Information of tashbarsephardicyeshivaketana.com
- Information of tashbarsephardicyeshivaketana.com
- Alexa Rank:Not ranked The Alexa rank is a measure of tashbarsephardicyeshivaketana.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from tashbarsephardicyeshivaketana.com over the last 3 months.
Google.com ranks #1 for example. - Quantcast Rank:Not ranked/Not available The Quantcast rank is a measure of tashbarsephardicyeshivaketana.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from tashbarsephardicyeshivaketana.com over the last 3 months.
Google.com ranks #1 for example. - Google Pagerank:Not ranked/Not available Google PageRank reflects the importance of web pages by considering more than 500 million variables and 2 billion terms. Pages that Google search engine believes are important receive a higher PageRank and are more likely to appear at the top of the search results.
PageRank also considers the importance of each page that casts a vote, as votes from some pages are considered to have greater value, thereby giving the linked page a greater value. - IP Address:192.185.116.168 IP Addresses are similar to physical addresses. It's a number that represents the identification and location of a website. Every computer has an IP address. - IP Tracing
- Site Age:9 years and 77 days
- Created:2015-08-26
- Expires:2017-08-26
- Updated:2016-08-19
- Owner:Afshin
- ICANN Registrar:NETEARTH ONE INC. D/B/A NETEARTH This shows the company who handled the registration of this domain.
- Hosted in:Unknown Region
- Domain Suffix:Commercial A domain suffix is the last part of a domain name and is often referred to as a "top-level domain" or TLD.
.COM is the most popular and it represents Commercial websites.
DNS Records of tashbarsephardicyeshivaketana.com
Host | Type | TTL | Extra |
---|---|---|---|
tashbarsephardicyeshivaketana.com | A | 14397 | IP: 192.185.116.168 |
tashbarsephardicyeshivaketana.com | NS | 86400 | Target: ns602.websitewelcome.com |
tashbarsephardicyeshivaketana.com | NS | 86400 | Target: ns601.websitewelcome.com |
tashbarsephardicyeshivaketana.com | SOA | 86400 | MNAME: ns601.websitewelcome.com RNAME: root.allante.websitewelcome.com Serial: 2016012900 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
tashbarsephardicyeshivaketana.com | MX | 14400 | Target: tashbarsephardicyeshivaketana.com |
tashbarsephardicyeshivaketana.com | TXT | 14400 | TXT: v=spf1 a mx include:websitewelcome.com ~all |
Name Servers of tashbarsephardicyeshivaketana.com
ns1.losangeleswebdesignfirm.com
ns2.losangeleswebdesignfirm.com
Header Info of tashbarsephardicyeshivaketana.com
tashbarsephardicyeshivaketana.com is using nginx/1.12.0 as server.
This website also uses compressing module Gzip to load pages faster.
Header | HTTP1.1 200 OK |
Server | nginx1.12.0 |
Date | Thu, 20 Apr 2017 130126 GMT |
Content-Type | texthtml; charset=utf-8 |
Transfer-Encoding | chunked |
Connection | keep-alive |
P3P | CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" |
Expires | Mon, 1 Jan 2001 000000 GMT |
Cache-Control | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
Pragma | no-cache |
Set-Cookie | b6c8e74bc48da2a18b4b0a787280481a=0bcdbced776877bba8a7739b5fb51903; path= Set-Cookie ja_pyrite_tpl=ja_pyrite; expires=Tue, 10-Apr-2018 130126 GMT; path= |
Last-Modified | Thu, 20 Apr 2017 130126 GMT |
Content-Encoding | gzip |
Search Engine & Internet Presense of tashbarsephardicyeshivaketana.com
A website with a large amount of indexed pages in search engines is more likely to have tons of visits.If you are buying tashbarsephardicyeshivaketana.com or it is your competitor checking how many pages indexed it has is vital.
If tashbarsephardicyeshivaketana.com has no pages indexed it means it's too new, is banned or suffered a penalty.
- Internet Presense of tashbarsephardicyeshivaketana.com
- Backlinks:2 This represents how many websites have links redirecting to tashbarsephardicyeshivaketana.com. Backlinks are very important for search engines since more backlinks mean more popularity leading to a better positioning on search engines.
- Google Indexed Pages:View This represents how many pages from tashbarsephardicyeshivaketana.com are currently visible to the public on Google search engine.
- Yahoo Indexed Pages:View This represents how many pages from tashbarsephardicyeshivaketana.com are currently visible to the public on Yahoo search engine.
- Bing Indexed Pages:View This represents how many pages from tashbarsephardicyeshivaketana.com are currently visible to the public on Bing search engine.
- Dmoz Listing:No
- Dmoz Title:None
- Dmoz Description:None
- Web Archive:tashbarsephardicyeshivaketana.com (in the past).
Useful links for Website Owners
This website seems not to be very popular. If you are the owner of it these links might help you to promote it and increase its presense on the internet.Submit it to Google - Submit it to Bing/Yahoo
Statistical Graphics of tashbarsephardicyeshivaketana.com
Select an option below to analyse several graphic statistics.Compare this website to:
Period:
IP Tracing of tashbarsephardicyeshivaketana.com
- Country:Not available
- City:Not available
- Region:Not available
- Latitude:Not available
- Longitude:Not available
- ASNum:Not available
- ISP:Not available
- Organization:Not available
Similar Domain Names of tashbarsephardicyeshivaketana.com
rashbarsephardicyeshivaketana.com, fashbarsephardicyeshivaketana.com, gashbarsephardicyeshivaketana.com, hashbarsephardicyeshivaketana.com, yashbarsephardicyeshivaketana.com, tqshbarsephardicyeshivaketana.com, twshbarsephardicyeshivaketana.com, tzshbarsephardicyeshivaketana.com, txshbarsephardicyeshivaketana.com, taqhbarsephardicyeshivaketana.com, tawhbarsephardicyeshivaketana.com, taehbarsephardicyeshivaketana.com, tazhbarsephardicyeshivaketana.com, taxhbarsephardicyeshivaketana.com, tachbarsephardicyeshivaketana.com, tasbbarsephardicyeshivaketana.com, tasgbarsephardicyeshivaketana.com, tastbarsephardicyeshivaketana.com, tasybarsephardicyeshivaketana.com, tasubarsephardicyeshivaketana.com, tasjbarsephardicyeshivaketana.com, tasmbarsephardicyeshivaketana.com, tasnbarsephardicyeshivaketana.com, tashvarsephardicyeshivaketana.com, tashfarsephardicyeshivaketana.com, tashgarsephardicyeshivaketana.com, tashharsephardicyeshivaketana.com, tashnarsephardicyeshivaketana.com, tashbqrsephardicyeshivaketana.com, tashbwrsephardicyeshivaketana.com, tashbzrsephardicyeshivaketana.com, tashbxrsephardicyeshivaketana.com, tashbaesephardicyeshivaketana.com, tashbadsephardicyeshivaketana.com, tashbafsephardicyeshivaketana.com, tashbagsephardicyeshivaketana.com, tashbatsephardicyeshivaketana.com, tashbarqephardicyeshivaketana.com, tashbarwephardicyeshivaketana.com, tashbareephardicyeshivaketana.com, tashbarzephardicyeshivaketana.com, tashbarxephardicyeshivaketana.com, tashbarcephardicyeshivaketana.com, tashbarswphardicyeshivaketana.com, tashbarssphardicyeshivaketana.com, tashbarsdphardicyeshivaketana.com, tashbarsfphardicyeshivaketana.com, tashbarsrphardicyeshivaketana.com, tashbarseohardicyeshivaketana.com, tashbarselhardicyeshivaketana.com, tashbarsepbardicyeshivaketana.com, tashbarsepgardicyeshivaketana.com, tashbarseptardicyeshivaketana.com, tashbarsepyardicyeshivaketana.com, tashbarsepuardicyeshivaketana.com, tashbarsepjardicyeshivaketana.com, tashbarsepmardicyeshivaketana.com, tashbarsepnardicyeshivaketana.com, tashbarsephqrdicyeshivaketana.com, tashbarsephwrdicyeshivaketana.com, tashbarsephzrdicyeshivaketana.com, tashbarsephxrdicyeshivaketana.com, tashbarsephaedicyeshivaketana.com, tashbarsephaddicyeshivaketana.com, tashbarsephafdicyeshivaketana.com, tashbarsephagdicyeshivaketana.com, tashbarsephatdicyeshivaketana.com, tashbarsepharxicyeshivaketana.com, tashbarsepharsicyeshivaketana.com, tashbarsepharwicyeshivaketana.com, tashbarsephareicyeshivaketana.com, tashbarsepharricyeshivaketana.com, tashbarsepharficyeshivaketana.com, tashbarsepharvicyeshivaketana.com, tashbarsepharcicyeshivaketana.com, tashbarsepharducyeshivaketana.com, tashbarsephardjcyeshivaketana.com, tashbarsephardkcyeshivaketana.com, tashbarsephardlcyeshivaketana.com, tashbarsephardocyeshivaketana.com, tashbarsephardixyeshivaketana.com, tashbarsephardisyeshivaketana.com, tashbarsephardidyeshivaketana.com, tashbarsephardifyeshivaketana.com, tashbarsephardivyeshivaketana.com, tashbarsephardicteshivaketana.com, tashbarsephardicgeshivaketana.com, tashbarsephardicheshivaketana.com, tashbarsephardicjeshivaketana.com, tashbarsephardicueshivaketana.com, tashbarsephardicywshivaketana.com, tashbarsephardicysshivaketana.com, tashbarsephardicydshivaketana.com, tashbarsephardicyfshivaketana.com, tashbarsephardicyrshivaketana.com, tashbarsephardicyeqhivaketana.com, tashbarsephardicyewhivaketana.com, tashbarsephardicyeehivaketana.com, tashbarsephardicyezhivaketana.com, tashbarsephardicyexhivaketana.com, tashbarsephardicyechivaketana.com, tashbarsephardicyesbivaketana.com, tashbarsephardicyesgivaketana.com, tashbarsephardicyestivaketana.com, tashbarsephardicyesyivaketana.com, tashbarsephardicyesuivaketana.com, tashbarsephardicyesjivaketana.com, tashbarsephardicyesmivaketana.com, tashbarsephardicyesnivaketana.com, tashbarsephardicyeshuvaketana.com, tashbarsephardicyeshjvaketana.com, tashbarsephardicyeshkvaketana.com, tashbarsephardicyeshlvaketana.com, tashbarsephardicyeshovaketana.com, tashbarsephardicyeshiaketana.com, tashbarsephardicyeshicaketana.com, tashbarsephardicyeshidaketana.com, tashbarsephardicyeshifaketana.com, tashbarsephardicyeshigaketana.com, tashbarsephardicyeshibaketana.com, tashbarsephardicyeshivqketana.com, tashbarsephardicyeshivwketana.com, tashbarsephardicyeshivzketana.com, tashbarsephardicyeshivxketana.com, tashbarsephardicyeshivauetana.com, tashbarsephardicyeshivajetana.com, tashbarsephardicyeshivametana.com, tashbarsephardicyeshivaletana.com, tashbarsephardicyeshivaoetana.com, tashbarsephardicyeshivakwtana.com, tashbarsephardicyeshivakstana.com, tashbarsephardicyeshivakdtana.com, tashbarsephardicyeshivakftana.com, tashbarsephardicyeshivakrtana.com, tashbarsephardicyeshivakerana.com, tashbarsephardicyeshivakefana.com, tashbarsephardicyeshivakegana.com, tashbarsephardicyeshivakehana.com, tashbarsephardicyeshivakeyana.com, tashbarsephardicyeshivaketqna.com, tashbarsephardicyeshivaketwna.com, tashbarsephardicyeshivaketzna.com, tashbarsephardicyeshivaketxna.com, tashbarsephardicyeshivaketaba.com, tashbarsephardicyeshivaketaga.com, tashbarsephardicyeshivaketaha.com, tashbarsephardicyeshivaketaja.com, tashbarsephardicyeshivaketama.com, tashbarsephardicyeshivaketanq.com, tashbarsephardicyeshivaketanw.com, tashbarsephardicyeshivaketanz.com, tashbarsephardicyeshivaketanx.com,Whois Record of tashbarsephardicyeshivaketana.com
Domain Name: TASHBARSEPHARDICYESHIVAKETANA.COM
Registry Domain ID: 1955571831_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.netearthone.com
Registrar URL: http://www.netearthone.com
Updated Date: 2016-08-19T23:43:58Z
Creation Date: 2015-08-26T19:51:12Z
Registrar Registration Expiration Date: 2017-08-26T19:51:12Z
Registrar: NetEarth One, Inc.
Registrar IANA ID: 1005
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Afshin
Registrant Organization: AA TECH DESIGN
Registrant Street: 1211 S. Shenandoah St. Suite 105
Registrant City: Los Angeles
Registrant State/Province: California
Registrant Postal Code: 90035
Registrant Country: US
Registrant Phone: +877.2283241
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [Spam Protected Email]
Registry Admin ID: Not Available From Registry
Admin Name: Afshin
Admin Organization: AA TECH DESIGN
Admin Street: 1211 S. Shenandoah St. Suite 105
Admin City: Los Angeles
Admin State/Province: California
Admin Postal Code: 90035
Admin Country: US
Admin Phone: +877.2283241
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [Spam Protected Email]
Registry Tech ID: Not Available From Registry
Tech Name: Afshin
Tech Organization: AA TECH DESIGN
Tech Street: 1211 S. Shenandoah St. Suite 105
Tech City: Los Angeles
Tech State/Province: California
Tech Postal Code: 90035
Tech Country: US
Tech Phone: +877.2283241
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [Spam Protected Email]
Name Server: ns1.losangeleswebdesignfirm.com
Name Server: ns2.losangeleswebdesignfirm.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +44 02030 26 99 87
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-04-20T13:01:25Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: AA TECH DESIGN
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is NetEarth One, Inc..
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
Registry Domain ID: 1955571831_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.netearthone.com
Registrar URL: http://www.netearthone.com
Updated Date: 2016-08-19T23:43:58Z
Creation Date: 2015-08-26T19:51:12Z
Registrar Registration Expiration Date: 2017-08-26T19:51:12Z
Registrar: NetEarth One, Inc.
Registrar IANA ID: 1005
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Afshin
Registrant Organization: AA TECH DESIGN
Registrant Street: 1211 S. Shenandoah St. Suite 105
Registrant City: Los Angeles
Registrant State/Province: California
Registrant Postal Code: 90035
Registrant Country: US
Registrant Phone: +877.2283241
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [Spam Protected Email]
Registry Admin ID: Not Available From Registry
Admin Name: Afshin
Admin Organization: AA TECH DESIGN
Admin Street: 1211 S. Shenandoah St. Suite 105
Admin City: Los Angeles
Admin State/Province: California
Admin Postal Code: 90035
Admin Country: US
Admin Phone: +877.2283241
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [Spam Protected Email]
Registry Tech ID: Not Available From Registry
Tech Name: Afshin
Tech Organization: AA TECH DESIGN
Tech Street: 1211 S. Shenandoah St. Suite 105
Tech City: Los Angeles
Tech State/Province: California
Tech Postal Code: 90035
Tech Country: US
Tech Phone: +877.2283241
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [Spam Protected Email]
Name Server: ns1.losangeleswebdesignfirm.com
Name Server: ns2.losangeleswebdesignfirm.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +44 02030 26 99 87
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-04-20T13:01:25Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: AA TECH DESIGN
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is NetEarth One, Inc..
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.